2.20 Rating by ClearWebStats
schoolforentrepreneurship.com is 4 years 10 months 2 days old. This website has a #17,999,908 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, schoolforentrepreneurship.com is SAFE to browse.
Get Custom Widget

Traffic Report of Schoolforentrepreneurship

Daily Unique Visitors: 27
Daily Pageviews: 54

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 17,999,908
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View schoolforentrepreneurship.com site advisor rating Not Applicable

Where is schoolforentrepreneurship.com server located?

Hosted IP Address:

23.236.62.147 View other site hosted with schoolforentrepreneurship.com

Hosted Country:

schoolforentrepreneurship.com hosted country US schoolforentrepreneurship.com hosted country

Location Latitude:

37.4043

Location Longitude:

-122.0748

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View schoolforentrepreneurship.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 9
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 23.236.62.147)

Jacksonville College, Private Junior College, Online Degree Programs

schoolforentrepreneurship.com favicon - jacksonville-college.edu

A Christian college located in Jacksonville, Texas. Jacksonville College offers the Associate of Arts and Associate of Science degrees online.

View schoolforentrepreneurship.com Pagerank   schoolforentrepreneurship.com alexa rank 1,914,903   schoolforentrepreneurship.com website value $ 480.00

The Nationwide Children's Hospital Columbus Marathon & 1/2 Marathon

schoolforentrepreneurship.com favicon - columbusmarathon.com

Nationwide Children's Hospital Columbus Marathon. Join us and become part of Ohio's largest marathon & 1/2 marathon.

View schoolforentrepreneurship.com Pagerank   schoolforentrepreneurship.com alexa rank 3,668,866   schoolforentrepreneurship.com website value $ 240.00

Vote smART Arizona 2014

schoolforentrepreneurship.com favicon - votesmartaz.com

Information for the arts and culture voter

View schoolforentrepreneurship.com Pagerank   schoolforentrepreneurship.com alexa rank Not Applicable   schoolforentrepreneurship.com website value $ 8.95

mcgreevys-2

schoolforentrepreneurship.com favicon - mcgreevysboston.com

View schoolforentrepreneurship.com Pagerank   schoolforentrepreneurship.com alexa rank 4,265,744   schoolforentrepreneurship.com website value $ 240.00

www.edmarcastaneda.com

schoolforentrepreneurship.com favicon - edmarcastaneda.com

jazz harpist edmar castaneda

View schoolforentrepreneurship.com Pagerank   schoolforentrepreneurship.com alexa rank 13,546,181   schoolforentrepreneurship.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 06 Jul 2019 05:42:05 GMT
Content-Type: text/html;charset=utf-8
Connection: keep-alive
X-Wix-Server-Artifact-Id: wix-public-war
X-Wix-Server-Artifact-Id: wix-public-html-renderer-webapp
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Expires: Thu, 01 Jan 1970 00:00:00 GMT
X-Accel-Buffering: no
X-Accel-Buffering: no
Content-Language: en-US
Vary: User-Agent
X-Seen-By: BTzakfJUbU/4CBguyutVd6K2Yutql/MbvsYyizNYz/A=,1wy2ILu/S4rlWT/R4rqCrevOYhH21aOeLZKA+Zso+0g=,LwsIp90Tma5sliyMxJYVEkN8SzL5Cc1qIRWSjXuKGVI=,I2ZOrNA1LIowGTY6Ll7mx+FTtZSk4cvA5p5AO/S8mKA=,1wy2ILu/S4rlWT/R4rqCraAahrNL48iSi9nPGV7lz3Y=,Tw2AanFDQ+Wwo8Xxk6ZL7vOBx+hvh2Cbd7MMNUXzbHHjvDj/+x+yiLv1JZX5jCEgQI0a5JhpIrhTG7nIoaljGOHAvzBCoV2tEyneC2VH2DY=,I2ZOrNA1LIowGTY6Ll7mx3F+uZxmFJjV4IrtQfnEamc=,1wy2ILu/S4rlWT/R4rqCrXM3nDj/Pts9oPMYdakYyIs=,CU5GbgCT5nWPaA3tUS4mLEfYqiSUH3iPb3exAEpXXvNp7bp29dNVaHQk2qGyiskzfuoSzYo0cvI9Oq3lt0Z/qg==
Cache-Control: no-store, no-cache
Cache-Control: no-cache
viewerVersion: 1.2938.0
Pragma: no-cache
Pragma: no-cache
X-NewRelic-App-Data: PxQFUlJRABABXVdRBQcOREgTYVYAMhEDXhFZAUxRW1xvSmoRQwhdBSdZWRUUDFRfVRY9TWRFRQMFXF9dBTQGDFQHSgdKe1tcRxdWDV0EQT5LRFIPAgZKERxUT1IbARlWXAgBAVdQW04BVwxRARQWCwNQWgMBUwdXAlBWBFIFDxEcAgAORFRq
Server-Timing: cache;desc=miss
Link: <https://static.parastorage.com/>; rel=preconnect; crossorigin,<https://fonts.gstatic.com>; rel=preconnect; crossorigin,<https://static.wixstatic.com/>; rel=preconnect;,<https://static.parastorage.com/services/wix-bolt/1.2938.0/bolt-main/app/bolt-custom-elements.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/[email protected]/requirejs.min.js>; rel=preload; as=script;,<https://static.parastorage.com/unpkg/[email protected]/lodash.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/[email protected]/dist/zepto.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://static.parastorage.com/services/wix-bolt/1.2938.0/bolt-main/app/main-r.min.js>; rel=preload; as=script ; crossorigin=anonymous;
X-Wix-Request-Id: 1562391725.1262900715176125243
Content-Encoding: gzip
Transfer-Encoding: chunked

Domain Information for schoolforentrepreneurship.com

Domain Registrar: NETWORK SOLUTIONS, LLC. schoolforentrepreneurship.com registrar info
Registration Date: 2019-06-27 4 years 10 months 2 days ago
Last Modified: 2019-06-27 4 years 10 months 2 days ago

Domain Nameserver Information

Host IP Address Country
ns2.wixdns.net schoolforentrepreneurship.com name server information 216.239.36.100 schoolforentrepreneurship.com server is located in United States United States
ns3.wixdns.net schoolforentrepreneurship.com name server information 216.239.38.100 schoolforentrepreneurship.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
schoolforentrepreneurship.com A 3599 IP:23.236.62.147
schoolforentrepreneurship.com NS 21599 Target:ns2.wixdns.net
schoolforentrepreneurship.com NS 21599 Target:ns3.wixdns.net
schoolforentrepreneurship.com SOA 3599 MNAME:ns2.wixdns.net
RNAME:support.wix.com
Serial:2019062705
Refresh:10800
Retry:3600
Expire:604800

Similarly Ranked Websites to Schoolforentrepreneurship

Bethlehem Pennsylvania Classifieds

schoolforentrepreneurship.com favicon - bethlehempennsylvaniaclassifieds.com

Post your Bethlehem Pennsylvania classified ad with Photos. You can buy, sell, advertise or promote with Bethlehem Pennsylvania Classifieds.

View schoolforentrepreneurship.com Pagerank   Alexa rank for schoolforentrepreneurship.com 17,999,912   website value of schoolforentrepreneurship.com $ 8.95

Producent profili budowlanych - Bella-Plast |

schoolforentrepreneurship.com favicon - bellaplast.com.pl

Specjalizujemy się w produkcji profili z tworzyw sztucznych dla budownictwa. Założycielami firmy jest zespół inżynierów, specjalistów od przetwórstwa tworzyw

View schoolforentrepreneurship.com Pagerank   Alexa rank for schoolforentrepreneurship.com 17,999,914   website value of schoolforentrepreneurship.com $ 8.95

::Benedeczki Műhely Kft.::

schoolforentrepreneurship.com favicon - benedeczkimuhely.hu

View schoolforentrepreneurship.com Pagerank   Alexa rank for schoolforentrepreneurship.com 17,999,923   website value of schoolforentrepreneurship.com $ 8.95

Home

schoolforentrepreneurship.com favicon - 3dgrounds.com

3DGrounds an Entertainment Production company.

View schoolforentrepreneurship.com Pagerank   Alexa rank for schoolforentrepreneurship.com 17,999,937   website value of schoolforentrepreneurship.com $ 8.95

حسين المصري لخدمات cnc

schoolforentrepreneurship.com favicon - h-cnc.com

View schoolforentrepreneurship.com Pagerank   Alexa rank for schoolforentrepreneurship.com 17,999,939   website value of schoolforentrepreneurship.com $ 8.95

Full WHOIS Lookup for schoolforentrepreneurship.com

Domain Name: SCHOOLFORENTREPRENEURSHIP.COM
Registry Domain ID: 2406746771_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2019-06-27T05:56:30Z
Creation Date: 2019-06-27T05:56:29Z
Registry Expiry Date: 2020-06-27T05:56:29Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS2.WIXDNS.NET
Name Server: NS3.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-07-06T05:41:45Z