Web stats for Schoolforentrepreneurship - schoolforentrepreneurship.com
2.20 Rating by ClearWebStats
schoolforentrepreneurship.com is 4 years 10 months 2 days old. This website has a #17,999,908 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, schoolforentrepreneurship.com is SAFE to browse.
Traffic Report of Schoolforentrepreneurship
Daily Unique Visitors: | 27 |
Daily Pageviews: | 54 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 17,999,908 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is schoolforentrepreneurship.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | 1 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 9 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 23.236.62.147)
Jacksonville College, Private Junior College, Online Degree Programs
- jacksonville-college.edu
A Christian college located in Jacksonville, Texas. Jacksonville College offers the Associate of Arts and Associate of Science degrees online.
The Nationwide Children's Hospital Columbus Marathon & 1/2 Marathon
- columbusmarathon.com
Nationwide Children's Hospital Columbus Marathon. Join us and become part of Ohio's largest marathon & 1/2 marathon.
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sat, 06 Jul 2019 05:42:05 GMT
Content-Type: text/html;charset=utf-8
Connection: keep-alive
X-Wix-Server-Artifact-Id: wix-public-war
X-Wix-Server-Artifact-Id: wix-public-html-renderer-webapp
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Expires: Thu, 01 Jan 1970 00:00:00 GMT
X-Accel-Buffering: no
X-Accel-Buffering: no
Content-Language: en-US
Vary: User-Agent
X-Seen-By: BTzakfJUbU/4CBguyutVd6K2Yutql/MbvsYyizNYz/A=,1wy2ILu/S4rlWT/R4rqCrevOYhH21aOeLZKA+Zso+0g=,LwsIp90Tma5sliyMxJYVEkN8SzL5Cc1qIRWSjXuKGVI=,I2ZOrNA1LIowGTY6Ll7mx+FTtZSk4cvA5p5AO/S8mKA=,1wy2ILu/S4rlWT/R4rqCraAahrNL48iSi9nPGV7lz3Y=,Tw2AanFDQ+Wwo8Xxk6ZL7vOBx+hvh2Cbd7MMNUXzbHHjvDj/+x+yiLv1JZX5jCEgQI0a5JhpIrhTG7nIoaljGOHAvzBCoV2tEyneC2VH2DY=,I2ZOrNA1LIowGTY6Ll7mx3F+uZxmFJjV4IrtQfnEamc=,1wy2ILu/S4rlWT/R4rqCrXM3nDj/Pts9oPMYdakYyIs=,CU5GbgCT5nWPaA3tUS4mLEfYqiSUH3iPb3exAEpXXvNp7bp29dNVaHQk2qGyiskzfuoSzYo0cvI9Oq3lt0Z/qg==
Cache-Control: no-store, no-cache
Cache-Control: no-cache
viewerVersion: 1.2938.0
Pragma: no-cache
Pragma: no-cache
X-NewRelic-App-Data: PxQFUlJRABABXVdRBQcOREgTYVYAMhEDXhFZAUxRW1xvSmoRQwhdBSdZWRUUDFRfVRY9TWRFRQMFXF9dBTQGDFQHSgdKe1tcRxdWDV0EQT5LRFIPAgZKERxUT1IbARlWXAgBAVdQW04BVwxRARQWCwNQWgMBUwdXAlBWBFIFDxEcAgAORFRq
Server-Timing: cache;desc=miss
Link: <https://static.parastorage.com/>; rel=preconnect; crossorigin,<https://fonts.gstatic.com>; rel=preconnect; crossorigin,<https://static.wixstatic.com/>; rel=preconnect;,<https://static.parastorage.com/services/wix-bolt/1.2938.0/bolt-main/app/bolt-custom-elements.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/[email protected]/requirejs.min.js>; rel=preload; as=script;,<https://static.parastorage.com/unpkg/[email protected]/lodash.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/[email protected]/dist/zepto.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://static.parastorage.com/services/wix-bolt/1.2938.0/bolt-main/app/main-r.min.js>; rel=preload; as=script ; crossorigin=anonymous;
X-Wix-Request-Id: 1562391725.1262900715176125243
Content-Encoding: gzip
Transfer-Encoding: chunked
Date: Sat, 06 Jul 2019 05:42:05 GMT
Content-Type: text/html;charset=utf-8
Connection: keep-alive
X-Wix-Server-Artifact-Id: wix-public-war
X-Wix-Server-Artifact-Id: wix-public-html-renderer-webapp
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Expires: Thu, 01 Jan 1970 00:00:00 GMT
X-Accel-Buffering: no
X-Accel-Buffering: no
Content-Language: en-US
Vary: User-Agent
X-Seen-By: BTzakfJUbU/4CBguyutVd6K2Yutql/MbvsYyizNYz/A=,1wy2ILu/S4rlWT/R4rqCrevOYhH21aOeLZKA+Zso+0g=,LwsIp90Tma5sliyMxJYVEkN8SzL5Cc1qIRWSjXuKGVI=,I2ZOrNA1LIowGTY6Ll7mx+FTtZSk4cvA5p5AO/S8mKA=,1wy2ILu/S4rlWT/R4rqCraAahrNL48iSi9nPGV7lz3Y=,Tw2AanFDQ+Wwo8Xxk6ZL7vOBx+hvh2Cbd7MMNUXzbHHjvDj/+x+yiLv1JZX5jCEgQI0a5JhpIrhTG7nIoaljGOHAvzBCoV2tEyneC2VH2DY=,I2ZOrNA1LIowGTY6Ll7mx3F+uZxmFJjV4IrtQfnEamc=,1wy2ILu/S4rlWT/R4rqCrXM3nDj/Pts9oPMYdakYyIs=,CU5GbgCT5nWPaA3tUS4mLEfYqiSUH3iPb3exAEpXXvNp7bp29dNVaHQk2qGyiskzfuoSzYo0cvI9Oq3lt0Z/qg==
Cache-Control: no-store, no-cache
Cache-Control: no-cache
viewerVersion: 1.2938.0
Pragma: no-cache
Pragma: no-cache
X-NewRelic-App-Data: PxQFUlJRABABXVdRBQcOREgTYVYAMhEDXhFZAUxRW1xvSmoRQwhdBSdZWRUUDFRfVRY9TWRFRQMFXF9dBTQGDFQHSgdKe1tcRxdWDV0EQT5LRFIPAgZKERxUT1IbARlWXAgBAVdQW04BVwxRARQWCwNQWgMBUwdXAlBWBFIFDxEcAgAORFRq
Server-Timing: cache;desc=miss
Link: <https://static.parastorage.com/>; rel=preconnect; crossorigin,<https://fonts.gstatic.com>; rel=preconnect; crossorigin,<https://static.wixstatic.com/>; rel=preconnect;,<https://static.parastorage.com/services/wix-bolt/1.2938.0/bolt-main/app/bolt-custom-elements.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/[email protected]/requirejs.min.js>; rel=preload; as=script;,<https://static.parastorage.com/unpkg/[email protected]/lodash.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/[email protected]/dist/zepto.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://static.parastorage.com/services/wix-bolt/1.2938.0/bolt-main/app/main-r.min.js>; rel=preload; as=script ; crossorigin=anonymous;
X-Wix-Request-Id: 1562391725.1262900715176125243
Content-Encoding: gzip
Transfer-Encoding: chunked
Domain Information for schoolforentrepreneurship.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
schoolforentrepreneurship.com | A | 3599 |
IP:23.236.62.147 |
schoolforentrepreneurship.com | NS | 21599 |
Target:ns2.wixdns.net |
schoolforentrepreneurship.com | NS | 21599 |
Target:ns3.wixdns.net |
schoolforentrepreneurship.com | SOA | 3599 |
MNAME:ns2.wixdns.net RNAME:support.wix.com Serial:2019062705 Refresh:10800 Retry:3600 Expire:604800 |
Similarly Ranked Websites to Schoolforentrepreneurship
Bethlehem Pennsylvania Classifieds
- bethlehempennsylvaniaclassifieds.com
Post your Bethlehem Pennsylvania classified ad with Photos. You can buy, sell, advertise or promote with Bethlehem Pennsylvania Classifieds.
Producent profili budowlanych - Bella-Plast |
- bellaplast.com.pl
Specjalizujemy się w produkcji profili z tworzyw sztucznych dla budownictwa. Założycielami firmy jest zespół inżynierów, specjalistów od przetwórstwa tworzyw
Full WHOIS Lookup for schoolforentrepreneurship.com
Domain Name: SCHOOLFORENTREPRENEURSHIP.COM
Registry Domain ID: 2406746771_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2019-06-27T05:56:30Z
Creation Date: 2019-06-27T05:56:29Z
Registry Expiry Date: 2020-06-27T05:56:29Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS2.WIXDNS.NET
Name Server: NS3.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-07-06T05:41:45Z
Registry Domain ID: 2406746771_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2019-06-27T05:56:30Z
Creation Date: 2019-06-27T05:56:29Z
Registry Expiry Date: 2020-06-27T05:56:29Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS2.WIXDNS.NET
Name Server: NS3.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-07-06T05:41:45Z